Passa al contenuto
Merck
Tutte le immagini(3)

Key Documents

AV09016

Sigma-Aldrich

Anti-HSP90AB1 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Heat shock protein 90 kDa α (cytosolic), class B member 1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(3)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

83 kDa

Reattività contro le specie

dog, guinea pig, goat, bovine, human, mouse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

NP_031381

N° accesso UniProt

P08238

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... HSP90AB1(3326)

Immunogeno

Synthetic peptide directed towards the N terminal region of human HSP90AB1

Azioni biochim/fisiol

HSP90AB1 (heat shock protein 90kDa α (cytosolic), class B member 1) is a molecular chaperone that mediates protein folding and intracellular trafficking. It interacts with important oncoproteins such as MET, Akt, p53 and Raf-1 kinase and modulates the signaling pathway that results in cell proliferation and survival.

Sequenza

Synthetic peptide located within the following region: MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDA

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Jared J Barrott et al.
The FEBS journal, 280(6), 1381-1396 (2013-01-30)
On the surface heat shock protein 90 (Hsp90) is an unlikely drug target for the treatment of any disease, let alone cancer. Hsp90 is highly conserved and ubiquitously expressed in all cells. There are two major isoforms α and β
Jooeun Bae et al.
Journal of immunology (Baltimore, Md. : 1950), 190(3), 1360-1371 (2013-01-08)
The 90-kDa heat shock protein (Hsp90) has become an important therapeutic target with ongoing evaluation in a number of malignancies. Although Hsp90 inhibitors have a high therapeutic index with limited effects on normal cells, they have been described to inhibit
Hui-Yu Chen et al.
Veterinary parasitology, 205(3-4), 540-550 (2014-10-02)
Anisakid nematodes are distributed worldwide in a wide variety of marine fishes and they are known to cause the zoonotic disease, anisakiasis. The temperature control is commonly applied for prevention and control of anisakiasis. To analyze the cellular response to
Balázs Rada et al.
Inflammation research : official journal of the European Histamine Research Society ... [et al.], 63(10), 821-830 (2014-07-23)
We studied the involvement of calcium and calcium-activated NADPH oxidases in NLRP3 inflammasome activation and IL-1β release to better understand inflammasome signaling in macrophages. Human volunteer blood donors were recruited to isolate monocytes to differentiate them into macrophages. Wild-type or
Xin Zhao et al.
Naunyn-Schmiedeberg's archives of pharmacology, 387(11), 1079-1089 (2014-08-12)
Arsenic trioxide (As2O3) is used to treat acute promyelocytic leukemia. However, the cardiotoxicity of long QT syndrome restricts its clinical application. Previous studies showed that As2O3 can damage the human ether-a-go-go-related gene (hERG) current via disturbing its trafficking to cellular

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.