219482

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable

Caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the cell-permeable Antennapedia internalization sequence (43-58).

• Sinonimo/i: Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, AP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin
• Formula empirica (notazione di Hill): C₂₂₈H₃₃₅N₆₁O₄₉S
• Peso molecolare: 4746.54
• Codice UNSPSC: 12352202
• NACRES: NA.77

Proprietà

• Livello qualitativo: 100
• Saggio: ≥95% (HPLC)
• Stato: lyophilized solid
• Produttore/marchio commerciale: Calbiochem^®
• Condizioni di stoccaggio: OK to freeze; desiccated (hygroscopic); protect from light
• Colore: white
• Solubilità: DMSO: 2 mg/mL
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C

Descrizione

Descrizione generale

Caveolin-1 scaffolding domain peptide (C1-SD_82-101) fused at the N-terminus to the cell-permeable Antennapedia internalization sequence (43-58). This peptide is reported to block eNOS activity and cellular NO release in vitro and reduce inflammation and tumorigenesis in vivo. Caveolin-1 interacts with several lipid-modified signaling ligands, such as EGFR, eNOS, G-protein α-subunits, PKCα, H-Ras, and Src, via the C1-SD_82-101 sequence.

Azioni biochim/fisiol

Cell permeable: yes

Primary Target
eNOS

Product does not compete with ATP.

Reversible: no

Confezionamento

Packaged under inert gas

Attenzione

Toxicity: Carcinogenic / Teratogenic (D)

Sequenza

H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Asp-Gly-Ile-Trp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Tyr-Arg-OH

Stato fisico

Supplied as a trifluoroacetate salt.

Ricostituzione

Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.

Altre note

Bernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA102, 761.
Williams, T.M., et al. 2004. J. Biol. Chem.279, 51630.
Gratton, J.P., et al. 2003. Cancer Cell4, 31.
Sukumaran, S.K., et al. 2002. J. Biol. Chem.277, 50716.
Liu, J., et al. 2002. J. Biol. Chem.277, 10661.
Bucci, M., et al. 2000. Nat. Med.6, 1362.
Okamoto, T., et al. 1998. J. Biol. Chem.273, 5419.

Note legali

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 11 - Combustible Solids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable