Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

WH0007409M1

Sigma-Aldrich

Monoclonal Anti-VAV1 antibody produced in mouse

clone 9C1, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-VAV, Anti-vav 1 oncogene

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

9C1, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2bκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... VAV1(7409)

Immunogène

VAV1 (AAH13361, 681 a.a. ~ 790 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

The role of vav protein in TCR-mediated signaling with MHC/peptide complexes leading to positive or negative selection of thymocytes
J Matuszyk
Post?py Higieny i Medycyny doswiadczalnej, 53 (1999)
Vav1: a key signal transducer downstream of the TCR
Victor Tybulewicz
Immunological Reviews (2003)
Role of substrates and products of PI 3-kinase in regulating activation of Rac-related guanosine triphosphatases
Vav. J Han
Science, 279 (1998)
Haiwen Li et al.
Oncology reports, 32(6), 2596-2604 (2014-10-22)
Nasopharyngeal carcinoma (NPC) is a leading cause of cancer-related mortality. Radiotherapy is one of the primary modalities for NPC treatment. However, in patients in the late stages of the disease, the local control rate and overall survival rate remain low.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique