Accéder au contenu
Merck
Toutes les photos(5)

Key Documents

SAB1403990

Sigma-Aldrich

Monoclonal Anti-IRF4, (C-terminal) antibody produced in mouse

clone 2D1, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

LSIRF, MUM1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2D1, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~38.21 kDa

Espèces réactives

human

Technique(s)

capture ELISA: suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotype

IgG2bκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... IRF4(3662)

Description générale

Interferon regulatory factor 4 (IRF4), also known as multiple myeloma oncogene-1 (MUM1), is a transcription factor. It is encoded by the gene mapped to human chromosome 6p25.3. The protein is specifically expressed in lymphocytes.

Immunogène

IRF4 (NP_002451, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE

Actions biochimiques/physiologiques

Interferon regulatory factor 4 (IRF4) plays a vital role in regulation of immunoglobulin class switch recombination and plasma cell differentiation. In addition, it is also implicated in maintaining homeostasis of both mature B and mature T lymphocytes. Mutation in the gene is associated with the risk of developing chronic lymphocytic leukemia (CLL).

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Prognostic significance of interferon regulating factor 4 (IRF4) in node-negative breast cancer.
Heimes AS, et al.
Journal of Cancer Research and Clinical Oncology, 143(7), 1123-1131 (2017)
Specificity of IRF4 Translocations for Primary Cutaneous Anaplastic Large Cell Lymphoma: a Multicenter Study of 204 Skin Biopsies
Wada DA, et al.
Modern Pathology, 24(4), 596-596 (2011)
Verification that common variation at 2q37.1, 6p25.3, 11q24.1, 15q23, and 19q13.32 influences chronic lymphocytic leukaemia risk
Crowther?Swanepoel D, et al.
British Journal of Haematology, 150(4), 473-479 (2010)
H W Mittrücker et al.
Science (New York, N.Y.), 275(5299), 540-543 (1997-01-24)
Lymphocyte-specific interferon regulatory factor (LSIRF) (now called IRF4) is a transcription factor expressed only in lymphocytes. Mice deficient in IRF4 showed normal distribution of B and T lymphocyes at 4 to 5 weeks of age but developed progressive generalized lymphadenopathy.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique