HPA023030

Anti-SLFN11 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-Schlafen family member 11
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA023030

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Séquence immunogène: REVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQPQRPITFTLKIVDVLKRGELYGYACMIRVNPFCCAVFSEAPNSWI
• Numéro d'accès UniProt: Q7Z7L1
• Application(s): research pathology
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SLFN11(91607)

Description

Description générale

SLFN proteins are found exclusively in mammals.

SLFN11 (schlafen family member 11) protein contains a putative AAA (ATPases associated with diverse cellular activities) domain. The gene is mapped to human chromosome 17q12.

Immunogène

Schlafen family member 11 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-SLFN11 antibody produced in rabbit has been used for immunohistochemistry study.

Actions biochimiques/physiologiques

SLFN proteins play a vital role in regulation of various biological functions such as cell-cycle arrest, differentiation, and cancer cell invasion. SLFN11 also acts as a dominant response factor of cancer cells to topoisomerase I inhibitors.

Schlafen (SLFN) genes are part of interferon-stimulated early response genes and are activated in the presence of pathogens by IRF3 (interferon regulatory factor 3) pathway. SLFN11 inhibits the generation of retroviruses, including human immunodeficiency virus 1 (HIV-1). It stops the production of viral proteins via codon-bias discrimination method. It also makes cancer cells sensitive to DNA-damaging agents.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST75872

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable