Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV51358

Sigma-Aldrich

Anti-JPH2 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-FLJ40969, Anti-JP-2, Anti-JP2, Anti-Junctophilin 2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

74 kDa

Espèces réactives

dog, human, horse, guinea pig, bovine, rat, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_065166

Numéro d'accès UniProt

Q9BR39

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... JPH2(57158)

Immunogène

Synthetic peptide directed towards the middle region of human JPH2

Application

Anti-JPH2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.

Actions biochimiques/physiologiques

Junctophilin 2 (JPH2; CMH17) is a member of the junctophilin family. The members of this family form the junctional complexes present between the plasma membrane and the endoplasmic/sarcoplasmic reticululm. JPH2 couples the sarcolemmal and the intracellular calcium channels in the skeletal and cardiac muscle. The expression of JPH2 is essential for the formation of postnatal T-tubule in mammals. Dysregulation of junctophilins result in a variety of cardiac disorders.

Séquence

Synthetic peptide located within the following region: ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Andrew P Landstrom et al.
Trends in molecular medicine, 20(6), 353-362 (2014-03-19)
Excitable tissues rely on junctional membrane complexes to couple cell surface signals to intracellular channels. The junctophilins have emerged as a family of proteins critical in coordinating the maturation and maintenance of this cellular ultrastructure. Within skeletal and cardiac muscle
David L Beavers et al.
Cardiovascular research, 103(2), 198-205 (2014-06-18)
Cardiomyocytes rely on a highly specialized subcellular architecture to maintain normal cardiac function. In a little over a decade, junctophilin-2 (JPH2) has become recognized as a cardiac structural protein critical in forming junctional membrane complexes (JMCs), which are subcellular domains
Yoshihisa Matsushita et al.
Journal of human genetics, 52(6), 543-548 (2007-05-04)
Junctophilin subtypes, designated as JPH1 approximately 4, are protein components of junctional complexes and play essential roles in cellular Ca2+ signaling in excitable cells. Knockout mice lacking the cardiac-type Jph2 die of embryonic cardiac arrest, and the mutant cardiac myocytes
Alejandro Garbino et al.
Physiological genomics, 37(3), 175-186 (2009-03-26)
Junctophilins (JPHs) are members of a junctional membrane complex protein family important for the physical approximation of plasmalemmal and sarcoplasmic/endoplasmic reticulum membranes. As such, JPHs facilitate signal transduction in excitable cells between plasmalemmal voltage-gated calcium channels and intracellular calcium release

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique