Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV39504

Sigma-Aldrich

Anti-PRDM12 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-PR domain containing 12

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

40 kDa

Espèces réactives

rat, human, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PRDM12(59335)

Description générale

PR domain proteins (PRDM) are a small family of kruppel-like zinc finger transcription factors involved in cell differentiation and tumorigenesis. PR domain containing 12 (PRDM12) is a putative tumor suppressor that may be implicated in poor outcome chronic myeloid leukemia (CML).

Spécificité

Anti-PRDM12 polyclonal antibody reacts with zebrafish, human, mouse, rat, and bovine PR domain containing 12 proteins.

Immunogène

Synthetic peptide directed towards the C terminal region of human PRDM12

Application

Anti-PRDM12 polyclonal antibody is used to tag PR domain containing 12 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of PR domain containing 12 protein in cell differentiation and tumorigenesis such as chronic myeloid leukemia.

Actions biochimiques/physiologiques

PRDM12 belongs to PR-domain family which are involved in human cancers in an unusual yin-yang fashion. Two products are normally produced from a PR-domain family member which differ by the presence or absence of the PR domain; the PR-plus product is disrupted or underexpressed whereas the PR-minus product is present or overexpressed in cancer cells. This imbalance in the amount of the two products, a result of either genetic or epigenetic events, appears to be an important cause of malignancy. PRDM12 may have a potential role in the pathogenesis of chronic myeloid leukaemia with derivative chromosome 9 deletion.

Séquence

Synthetic peptide located within the following region: NHVRLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRPPSTALQAHSPAL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique