Accéder au contenu
Merck
Toutes les photos(2)

Documents

AV34622

Sigma-Aldrich

Anti-KCNIP4 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Kv channel interacting protein 4

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

29 kDa

Espèces réactives

mouse, rat, rabbit, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_079497

Numéro d'accès UniProt

Q6PIL6

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... KCNIP4(80333)

Description générale

KCNIP4 is a protein member of the voltage-gated potassium (Kv) channel-interacting family. This protein is known to associate with calcium and presenilin. KCNIP4 has been implicated as a candidate gene for renal cancer, personality and attention-deficit/hyperactivity disorders (PD and ADHD), and asthma.
Rabbit Anti-KCNIP4 antibody recognizes human, mouse, rat, bovine, and canine KCNIP4.

Immunogène

Synthetic peptide directed towards the N terminal region of human KCNIP4

Application

Rabbit Anti-KCNIP4 antibody is suitable for western blot (1.0 μg/ml) and IHC (4-8 μg/ml) applications.

Actions biochimiques/physiologiques

KCNIP4 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin.

Séquence

Synthetic peptide located within the following region: NSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Lena Weißflog et al.
European neuropsychopharmacology : the journal of the European College of Neuropsychopharmacology, 23(6), 436-447 (2012-09-18)
Attention-deficit/hyperactivity disorder (ADHD) is a neurodevelopmental disorder in children with striking persistence into adulthood and a high co-morbidity with other psychiatric disorders, including personality disorders (PD). The 4p15.31 region was shown to be associated with ADHD in several genome wide
Anita Bonne et al.
Cancer genetics and cytogenetics, 179(1), 11-18 (2007-11-06)
Our group and others had previously developed a high throughput procedure to map translocation breakpoints using chromosome flow sorting in conjunction with microarray-based comparative genomic hybridization (arrayCGH). Here we applied both conventional positional cloning and integrated arrayCGH procedures to the
Blanca E Himes et al.
PloS one, 8(2), e56179-e56179 (2013-03-05)
Asthma is a common chronic respiratory disease characterized by airway hyperresponsiveness (AHR). The genetics of asthma have been widely studied in mouse and human, and homologous genomic regions have been associated with mouse AHR and human asthma-related phenotypes. Our goal

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique