Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

AV35307

Sigma-Aldrich

Anti-MCOLN1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Mucolipin 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

64 kDa

Espèces réactives

pig, rabbit, dog, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MCOLN1(57192)

Description générale

MCOLN1 codes for a transmembrane protein that is found in vesicles. It is involved in endocytosis and lysosomal exocytosis. MCOLN1 mutations have been associated with the neurodegenerative lysosomal storage disorder, mucolipidosis type IV (MLIV).
Rabbit Anti-MCOLN1 antibody recognizes bovine, canine, human, rat, and mouse MCOLN1.

Immunogène

Synthetic peptide directed towards the N terminal region of human MCOLN1

Application

Rabbit Anti-MCOLN1 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.

Actions biochimiques/physiologiques

MCOLN1 encodes a protein that may be involved in calcium signaling and membrane trafficking in mucolipidosis IV.

Séquence

Synthetic peptide located within the following region: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Gideon Bach et al.
Human mutation, 26(6), 591-591 (2005-11-16)
Mucolipidosis type IV (MLIV) is a neurodegenerative lysosomal storage disorder that occurs in an increased frequency in the Ashkenazi Jewish (AJ) population. The frequency of the disease in this population has been established by the testing of 66,749 AJ subjects
Math P Cuajungco et al.
Traffic (Copenhagen, Denmark), 15(11), 1247-1265 (2014-08-19)
Mucolipidosis type IV (MLIV) is caused by loss of function mutations in the TRPML1 ion channel. We previously reported that tissue zinc levels in MLIV were abnormally elevated; however, the mechanism behind this pathologic accumulation remains unknown. Here, we identify

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique