Accéder au contenu
Merck
Toutes les photos(5)

Key Documents

AV32537

Sigma-Aldrich

Anti-POU2F3 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-POU domain, class 2, transcription factor 3

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(5)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

47 kDa

Espèces réactives

guinea pig, dog, rabbit, human, rat, sheep, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_055167

Numéro d'accès UniProt

Q9UKI9

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... POU2F3(25833)

Catégories apparentées

Description générale

POU2F3, also known as Skn-1a and OCT11, gene is mapped to human chromosome 11q23.3. The gene codes for a keratinocyte-specific POU transcription factor. The protein is expressed in stratified squamous epithelia, including the epidermis, cervix and foreskin.

Immunogène

Synthetic peptide directed towards the N terminal region of human POU2F3

Application

Rabbit Anti-POU2F3 antibody can be used for western blotting applications at a concentration of 0.5μg/ml. It can also be used for IHC assays at 4-8μg/ml, using paraffin-embedded tissues.

Actions biochimiques/physiologiques

POU2F3 is a transcription factor that is involved in the growth and differentiation of keratinocytes. Studies have reported that Pou2f3 (Skn-1a) is involved in the differentiation of chemosensory cells. Furthermore, this transcription factor is also required for specifying the lineage of taste receptor cells.

Séquence

Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Makoto Ohmoto et al.
Bioscience, biotechnology, and biochemistry, 77(10), 2154-2156 (2013-10-08)
Solitary chemosensory cells in the non-neuronal epithelium of the anterior nasal cavity have bitter taste cell-like molecular characteristics and are involved in the detection of noxious substances. Here, we demonstrate that Pou2f3/Skn-1a, which is necessary for generation of sweet, umami
Ichiro Matsumoto et al.
Nature neuroscience, 14(6), 685-687 (2011-05-17)
Functional diversification of taste cells is crucial for proper discrimination of taste qualities. We found the homeodomain protein Skn-1a (Pou2f3) to be expressed in sweet, umami and bitter taste cells. Skn-1a-deficient mice lacked electrophysiological and behavioral responses to sweet, umami
Z Zhang et al.
Oncogene, 25(39), 5436-5445 (2006-04-12)
POU2F3 (OCT11, Skn-1a) is a keratinocyte-specific POU transcription factor whose expression is tied to squamous epithelial stratification. It is also a candidate tumor suppressor gene in cervical cancer (CC) because it lies in a critical loss of heterozygosity region on

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique