Saltar al contenido
Merck
Todas las fotos(7)

Documentos clave

WH0007150M1

Sigma-Aldrich

Monoclonal Anti-TOP1 antibody produced in mouse

clone 1A1, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-TOPI, Anti-topoisomerase (DNA) I

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

1A1, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human

técnicas

ELISA: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL

isotipo

IgG1κ

Nº de acceso GenBank

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... TOP1(7150)

Descripción general

The gene TOP1 (DNA topoisomerase 1) is mapped to human chromosome 20q12-q13.1. The protein localizes in the nucleus.

Inmunógeno

TOP1 (NP_003277, 692 a.a. ~ 765 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF

Acciones bioquímicas o fisiológicas

DNA topoisomerases cause single (type-1) or double (type-2) strand DNA breaks, leading to DNA relaxation. They control DNA replication, transcription, recombination and chromatin remodeling. TOP1 (DNA topoisomerase 1) binds to the promoters and thereby induces nucleosome disassembly, histone acetylation and gene expression. Camptothecin is a non-competitive TOP1 inhibitor. TOP1 also controls alternative splicing through phosphorylation of serine/arginine-rich proteins. It is up-regulated in non-small cell lung cancer (NSCLC).

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Rhythmic binding of Topoisomerase I impacts on the transcription of Bmal1 and circadian period.
Yoshiaki Onishi
Nucleic Acids Research, 40 (2012)
Correlation between topoisomerase I and tyrosyl-DNA phosphodiesterase 1 activities in non-small cell lung cancer tissue
Ann-Katrine Jakobsen
Experimental and Molecular Pathology, 99 (2015)
Sumoylation of topoisomerase I is involved in its partitioning between nucleoli and nucleoplasm and its clearing from nucleoli in response to camptothecin
Prasad Rallabhandi
The Journal of Biological Chemistry, 27 (2002)
Salim Khiati et al.
Molecular pharmacology, 86(2), 193-199 (2014-06-04)
Lamellarin D (Lam-D) is a hexacyclic pyrole alkaloid isolated from marine invertebrates, whose biologic properties have been attributed to mitochondrial targeting. Mitochondria contain their own DNA (mtDNA), and the only specific mitochondrial topoisomerase in vertebrates is mitochondrial topoisomerase I (Top1mt).
Elevated expression levels of NCOA3, TOP1, and TFAP2C in breast tumors as predictors of poor prognosis
Chen Zhao
Cancer, 98 (2003)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico