WH0006774M2
Monoclonal Anti-STAT3 antibody produced in mouse
clone 4D6, purified immunoglobulin, buffered aqueous solution
Sinónimos:
Anti-APRF, Anti-FLJ20882, Anti-MGC16063, Anti-signal transducer and activator of transcription 3 (acute-phase response factor)
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Productos recomendados
origen biológico
mouse
conjugado
unconjugated
forma del anticuerpo
purified immunoglobulin
tipo de anticuerpo
primary antibodies
clon
4D6, monoclonal
formulario
buffered aqueous solution
reactividad de especies
human
técnicas
indirect ELISA: suitable
indirect immunofluorescence: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL
isotipo
IgG1κ
Nº de acceso GenBank
Nº de acceso UniProt
Condiciones de envío
dry ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... STAT3(6774)
Descripción general
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described. (provided by RefSeq)
Inmunógeno
STAT3 (NP_003141, 670 a.a. ~ 769 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
Sequence
LVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
Forma física
Solution in phosphate buffered saline, pH 7.4
Información legal
GenBank is a registered trademark of United States Department of Health and Human Services
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Opcional
Referencia del producto
Descripción
Precios
Código de clase de almacenamiento
10 - Combustible liquids
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Equipo de protección personal
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Heather Francis et al.
The Journal of biological chemistry, 289(40), 27526-27539 (2014-08-15)
IL-6/Stat3 is associated with the regulation of transcription of key cellular regulatory genes (microRNAs) during different types of liver injury. This study evaluated the role of IL-6/Stat3 in regulating miRNA and miR-21 in alcoholic liver disease. By microarray, we identified
Down-regulation of ATBF1 activates STAT3 signaling via PIAS3 in pacing-induced HL-1 atrial myocytes.
Qi Jiang et al.
Biochemical and biophysical research communications, 449(3), 278-283 (2014-05-27)
Atrial fibrillation (AF) is progressive and is the most common clinical arrhythmia. It is associated with inflammatory changes characterized by signal transducer and activator of transcription 3 (STAT3) signaling. A zinc finger homeobox 3 (ZFHX3, also named AT-motif binding factor
Selective ALK inhibitor alectinib with potent antitumor activity in models of crizotinib resistance.
Tatsushi Kodama et al.
Cancer letters, 351(2), 215-221 (2014-06-03)
The clinical efficacy of the ALK inhibitor crizotinib has been demonstrated in ALK fusion-positive NSCLC; however, resistance to crizotinib certainly occurs through ALK secondary mutations in clinical use. Here we examined the efficacy of a selective ALK inhibitor alectinib/CH5424802 in
Valeriya Gyurkovska et al.
Inflammation, 37(4), 995-1005 (2014-01-30)
Tyrphostin AG490 is a Janus kinase (JAK) 2 inhibitor that is clinically used as an anticancer agent and is also effective in various models of inflammatory and autoimmune diseases. In this study, we examined the effects of tyrphostin AG490 on
Vladimir N Ivanov et al.
Apoptosis : an international journal on programmed cell death, 19(12), 1736-1754 (2014-10-03)
Ionizing radiation alone or in combination with chemotherapy is the main treatment modality for brain tumors including glioblastoma. Adult neurons and astrocytes demonstrate substantial radioresistance; in contrast, human neural stem cells (NSC) are highly sensitive to radiation via induction of
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico