SAB5702843

Anti-ApoB Antibody, clone 2T5X0, Rabbit Monoclonal

• Sinónimos: FLDB, LDLCQ4, apoB-100, apoB-48
• Código UNSPSC: 12352203
• NACRES: NA.46

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• Materiales: colorless
• clon: 2T5X0, monoclonal
• formulario: liquid
• reactividad de especies: mouse, rat
• concentración: 0.74 mg/mL
• técnicas: western blot: 1:500 - 1:2000
• color: colorless
• isotipo: IgG
• secuencia del inmunógeno: RKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEP
• Nº de acceso UniProt: P04114
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... APOB(338)

Descripción

Descripción general

This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels. [provided by RefSeq, Jul 2008]

Inmunógeno

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ApoB (P04114).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Aplicación

WB

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1