SAB5702551

Anti-MAP Kinase- ERK1/ERK2 Antibody

rabbit monoclonal, 2Z8O1

• Sinónimos: ERK, ERK-2, ERK2, ERT1, MAPK2, P42MAPK, PRKM1, PRKM2, p38, p40, p41, p41mapk, p42-MAPK, 5594/5595
• Código UNSPSC: 12352203
• NACRES: NA.46

Propiedades

• Nombre del producto: Anti-ERK1/2 Antibody, clone 2Z8O1, Rabbit Monoclonal,
• origen biológico: rabbit
• Nivel de calidad: 100
• Materiales: colorless
• clon: 2Z8O1, monoclonal
• Formulario: liquid
• reactividad de especies: rat, rat, human
• concentración: 0.25 mg/mL
• técnicas: immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; immunoprecipitation (IP): 1:50 - 1:200; western blot: 1:1000 - 1:2000
• color: colorless
• isotipo: IgG
• secuencia del inmunógeno: HTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
• Nº de acceso UniProt: P27361; P28482
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MAPK1(5594) , MAPK3(5595)

Descripción

Descripción general

This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. [provided by RefSeq, Jan 2014]

Inmunógeno

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 180-360 of human ERK1/2 (P28482).

Aplicación

WB, IHC, IF/ICC, IP

Información de seguridad

• Pictogramas: GHS07,GHS09
• Palabra de señalización: Warning
• Frases de peligro: H317,H411
• Consejos de prudencia: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Clasificaciones de peligro: Aquatic Chronic 2 - Skin Sens. 1
• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3