SAB2109009

Anti-PAK6 (C-terminal) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: PAK5, PAK6
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 74 kDa
• reactividad de especies (predicha por homología): bovine, canine, guinea pig, goat, horse, rabbit, human, mouse
• concentración: 0.5 mg/mL
• técnicas: western blot: 1 μg/mL
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... PAK6(57396)

Descripción

Descripción general

This gene encodes a member of a family of p21-stimulated serine/threonine protein kinases, which contain an amino-terminal Cdc42/Rac interactive binding (CRIB) domain and a carboxyl-terminal kinase domain. These kinases function in a number of cellular processes, including cytoskeleton rearrangement, apoptosis, and the mitogen-activated protein (MAP) kinase signaling pathway. The protein encoded by this gene interacts with androgen receptor (AR) and translocates to the nucleus, where it is involved in transcriptional regulation. Changes in expression of this gene have been linked to prostate cancer. Alternative splicing results in multiple transcript variants.

Inmunógeno

Synthetic peptide directed towards the C-terminal region of Human PAK6

Secuencia

Synthetic peptide located within the following region: LRDFLERMLVRDPQERATAQELLDHPFLLQTGLPECLVPLIQLYRKQTST

Forma física

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): nwg
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable