SAB2106776

Anti-FTO antibody produced in rabbit

affinity isolated antibody

• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 58 kDa
• reactividad de especies: human, dog, bovine, sheep, horse, pig, mouse, rat
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NM_011936
• Nº de acceso UniProt: Q8BGW1
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... FTO(79068) ; mouse ... Fto(26383)

Descripción

Inmunógeno

Synthetic peptide directed towards the N terminal of human FTO

Acciones bioquímicas o fisiológicas

Fto is a dioxygenase that repairs alkylated DNA and RNA by oxidative demethylation. Fto has highest activity towards single-stranded RNA containing 3-methyluracil, followed by single-stranded DNA containing 3-methylthymine. Fto has low demethylase activity towards single-stranded DNA containing 1-methyladenine or 3-methylcytosine. Fto has no activity towards 1-methylguanine and no detectable activity towards double-stranded DNA. Fto requires molecular oxygen, alpha-ketoglutarate and iron. Fto contributes to the regulation of the global metabolic rate, energy expenditure and energy homeostasis. Fto contributes to the regulation of body size and body fat accumulation.

Secuencia

Synthetic peptide located within the following region: MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable