SAB2103803

Anti-MARCH5, (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-FLJ20445, Anti-MARCH-V, Anti-MITOL, Anti-RNF153
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• forma del anticuerpo: affinity isolated antibody
• Nivel de calidad: 100
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 31 kDa
• reactividad de especies: mouse, rat, bovine, dog, rabbit, horse, guinea pig, human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NM_017824
• Nº de acceso UniProt: Q9NX47
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MARCH5(54708)

Descripción

Inmunógeno

Synthetic peptide directed towards the N terminal region of human MARCH5

Acciones bioquímicas o fisiológicas

MARCH5 is an ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2) and DRP1 (DNM1L). MARCH5 is a ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2; MIM 608507) and DRP1 (DNM1L; MIM 603850) (Nakamura et al., 2006 [PubMed 16936636]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1502 AK000452.1 3-1504 1503-1863 BC015480.1 1463-1823 1864-1901 BE393612.1 438-475 1902-3713 BC015480.1 1852-3663 3714-3941 BC015480.1 3669-3896

Secuencia

Synthetic peptide located within the following region: CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable