Saltar al contenido
Merck
Todas las fotos(2)

Key Documents

SAB2102064

Sigma-Aldrich

Anti-RUNX1 (ab2) antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-AML1, Anti-AML1-EVI-1, Anti-AMLCR1, Anti-CBFA2, Anti-Runt-related transcription factor 1 (acute myeloid leukemia 1; aml1 oncogene)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

Número MDL:
MFCD07370485
Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

52 kDa

reactividad de especies

dog, rabbit, guinea pig, rat, bovine, human, horse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso UniProt

Q01196

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... RUNX1(861)

Descripción general

The previously assigned protein identifier B2RMS4 has been merged into Q01196. Full details can be found on the UniProt database.

Inmunógeno

Synthetic peptide directed towards the middle region of human RUNX1

Aplicación

Anti-RUNX1 (ab2) antibody produced in rabbit is suitable for western blot.

Acciones bioquímicas o fisiológicas

Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. RUNX1 is the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with severaltypes of leukemia. Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene.

Secuencia

Synthetic peptide located within the following region: CTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Kentson Lam et al.
Frontiers in bioscience (Landmark edition), 17, 1120-1139 (2011-12-29)
RUNX1 is a transcription factor that regulates critical processes in many aspects of hematopoiesis. RUNX1 is also integral in defining the definitive hematopoietic stem cell. In addition, many hematological diseases like myelodysplastic syndrome and myeloproliferative neoplasms have been associated with
Ming Zhuang et al.
Biochemical and biophysical research communications, 448(3), 315-322 (2014-01-07)
The lncRNA H19 has been recently shown to be upregulated and play important roles in gastric cancer tumorigenesis. However, the precise molecular mechanism of H19 and its mature product miR-675 in the carcinogenesis of gastric cancer remains unclear. In this
Hiroshi Yajima et al.
BMC biology, 12, 40-40 (2014-06-03)
Various senses and sensory nerve architectures of animals have evolved during adaptation to exploit diverse environments. In craniates, the trunk sensory system has evolved from simple mechanosensory neurons inside the spinal cord (intramedullary), called Rohon-Beard (RB) cells, to multimodal sensory
Yu Fei Lee et al.
PloS one, 9(9), e106661-e106661 (2014-09-05)
The orchestration of histone modifiers is required to establish the epigenomic status that regulates gene expression during development. Whsc1 (Wolf-Hirschhorn Syndrome candidate 1), a histone H3 lysine 36 (H3K36) trimethyltransferase, is one of the major genes associated with Wolf-Hirshhorn syndrome

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico