AV38073
Anti-RUNX1 antibody produced in rabbit
affinity isolated antibody
Sinónimos:
Anti-Runt-elated transcription factor 1 (acute myeloid leukemia 1; aml1 oncogene)
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Formulario
buffered aqueous solution
mol peso
12 kDa
reactividad de especies
mouse, bovine, guinea pig, dog, rabbit, human, rat, horse
concentración
0.5 mg - 1 mg/mL
técnicas
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... RUNX1(861)
Descripción general
Runt-related transcription factor 1 (RUNX1) is a transcription factor that plays an important role in hematopoiesis, osteogenesis and neurogenesis. It is a member of Runt-related transcription factors (RUNXs). It was first identified as a component of Polyomavirus enhancer binding protein 2 (PEBP2) and Moloney murine leukemia virus enhancer core binding factor (CBF). Three isoforms of the protein have been identified: RUNX1a, RUNX1b and RUNX1c. Structurally, it consists of Runt domain at the N-terminal region.
Inmunógeno
Synthetic peptide directed towards the N terminal region of human RUNX1
Aplicación
Anti-RUNX1 antibody produced in rabbit is suitable for western blot.
Acciones bioquímicas o fisiológicas
RUNX1 (Runt-related transcription factor 1) plays a vital role in tumour suppression and oncogenic activities. In hematopoiesis, it is involved in hematopoietic development, hematopoietic stem cell homeostasis, and various blood malignancies. It may have clinicopathological impact on the proliferation of human bone marrow cells used in transplantation therapy.
Secuencia
Synthetic peptide located within the following region: KMPAAPRGPAQGEAAARTRSRDASTSRRFTPPSTALSPGKMSEALPLGAP
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 2
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Qingliang Zheng et al.
Journal of immunology (Baltimore, Md. : 1950), 196(3), 1317-1326 (2015-12-25)
Upon recognition of viral components by pattern recognition receptors, including TLRs and retinoic acid-inducible gene I-like helicases, cells are activated to produce type I IFN, which plays key roles in host antiviral innate immune response. However, excessive IFN production may
Kentson Lam et al.
Frontiers in bioscience (Landmark edition), 17, 1120-1139 (2011-12-29)
RUNX1 is a transcription factor that regulates critical processes in many aspects of hematopoiesis. RUNX1 is also integral in defining the definitive hematopoietic stem cell. In addition, many hematological diseases like myelodysplastic syndrome and myeloproliferative neoplasms have been associated with
Ming Zhuang et al.
Biochemical and biophysical research communications, 448(3), 315-322 (2014-01-07)
The lncRNA H19 has been recently shown to be upregulated and play important roles in gastric cancer tumorigenesis. However, the precise molecular mechanism of H19 and its mature product miR-675 in the carcinogenesis of gastric cancer remains unclear. In this
Hiroshi Yajima et al.
BMC biology, 12, 40-40 (2014-06-03)
Various senses and sensory nerve architectures of animals have evolved during adaptation to exploit diverse environments. In craniates, the trunk sensory system has evolved from simple mechanosensory neurons inside the spinal cord (intramedullary), called Rohon-Beard (RB) cells, to multimodal sensory
Yu Fei Lee et al.
PloS one, 9(9), e106661-e106661 (2014-09-05)
The orchestration of histone modifiers is required to establish the epigenomic status that regulates gene expression during development. Whsc1 (Wolf-Hirschhorn Syndrome candidate 1), a histone H3 lysine 36 (H3K36) trimethyltransferase, is one of the major genes associated with Wolf-Hirshhorn syndrome
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico