SAB2100822
Anti-FLI1 antibody produced in rabbit
affinity isolated antibody
Sinónimos:
Anti-EWSR2, Anti-Friend leukemia virus integration 1, Anti-SIC-1
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Formulario
buffered aqueous solution
mol peso
51 kDa
reactividad de especies
dog, human, rabbit, guinea pig, bovine
concentración
0.5 mg - 1 mg/mL
técnicas
immunohistochemistry: suitable
western blot: suitable
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... FLI1(2313)
Categorías relacionadas
Descripción general
Fli-1 proto-oncogene, ETS transcription factor (FLI1) is encoded by the gene mapped to human chromosome 11. The encoded protein belongs to the ETS family of transcription factors. FLI1 consists of ETS DNA-binding domain at its C-terminal end and is mainly expressed in hematopoietic and vascular endothelial cells.
Inmunógeno
Synthetic peptide directed towards the middle region of human FLI1
Aplicación
Anti-FLI1 antibody produced in rabbit has been used in chromatin immunoprecipitation.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Chromatin immunoprecipitation (1 paper)
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Chromatin immunoprecipitation (1 paper)
Chromatin immunoprecipitation (1 paper)
Acciones bioquímicas o fisiológicas
Fli-1 proto-oncogene, ETS transcription factor (FLI1) acts as a sequence-specific transcriptional activator. It might be implicated in the development of both the haematopoietic and vascular systems. In addition, it also plays a vital role in megakaryopoiesis and platelet function. FLI1 functions as a regulator of essential midkine (MK) genes. Mutations in FLI1 is associated with the pathogenesis of Paris-Trousseau syndrome and congenital thrombocytopenia.
Secuencia
Synthetic peptide located within the following region: FDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMP
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 3
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
The Fli-1 proto-oncogene, involved in erythroleukemia and Ewing's sarcoma, encodes a transcriptional activator with DNA-binding specificities distinct from other Ets family members.
Zhang L
Oncogene, 8(6), 1621-1630 (1993)
Marco Fidaleo et al.
Oncotarget, 6(31), 31740-31757 (2015-10-10)
Alternative splicing plays a key role in the DNA damage response and in cancer. Ewing Sarcomas (ES) are aggressive tumors caused by different chromosomal translocations that yield in-frame fusion proteins driving transformation. RNA profiling reveals genes differentially regulated by UV
EWS, but not EWS-FLI-1, is associated with both TFIID and RNA polymerase II: interactions between two members of the TET family, EWS and hTAFII68, and subunits of TFIID and RNA polymerase II complexes.
Bertolotti A
Molecular and Cellular Biology, 18(3), 1489-1497 (1998)
Macrothrombocytopenia and dense granule deficiency associated with FLI1 variants: ultrastructural and pathogenic features.
Saultier P
Haematologica, 102(6), 1006-1016 (2017)
Molecular characterization of an 11q interstitial deletion in a patient with the clinical features of Jacobsen syndrome.
Wenger SL
American Journal of Medical Genetics. Part A, 140(7), 704-708 (2006)
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico