SAB1403990

Monoclonal Anti-IRF4, (C-terminal) antibody produced in mouse

clone 2D1, purified immunoglobulin, buffered aqueous solution

• Sinónimos: LSIRF, MUM1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2D1, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~38.21 kDa
• reactividad de especies: human
• técnicas: capture ELISA: suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2bκ
• Nº de acceso NCBI: NM_002460
• Nº de acceso UniProt: Q15306
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... IRF4(3662)

Descripción

Descripción general

Interferon regulatory factor 4 (IRF4), also known as multiple myeloma oncogene-1 (MUM1), is a transcription factor. It is encoded by the gene mapped to human chromosome 6p25.3. The protein is specifically expressed in lymphocytes.

Inmunógeno

IRF4 (NP_002451, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE

Acciones bioquímicas o fisiológicas

Interferon regulatory factor 4 (IRF4) plays a vital role in regulation of immunoglobulin class switch recombination and plasma cell differentiation. In addition, it is also implicated in maintaining homeostasis of both mature B and mature T lymphocytes. Mutation in the gene is associated with the risk of developing chronic lymphocytic leukemia (CLL).

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable