SAB1402570

Monoclonal Anti-PCSK1N, (C-terminal) antibody produced in mouse

clone 1E9, purified immunoglobulin, buffered aqueous solution

• Sinónimos: PROSAAS, SAAS
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1E9, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen ~35.79 kDa
• reactividad de especies: human
• técnicas: immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_013271
• Nº de acceso UniProt: Q9UHG2
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... PCSK1N(27344)

Descripción

Descripción general

Members of the subtilisin-like proprotein convertase family process latent precursor proteins into their biologically active products. The protein encoded by this gene appears to function as an endogenous inhibitor of proprotein convertase subtilisin/kexin type 1. (provided by RefSeq)

Inmunógeno

PCSK1N (NP_037403.1, 173 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable