SAB1402013

Monoclonal Anti-RDH12 antibody produced in mouse

clone 1E11, purified immunoglobulin, buffered aqueous solution

• Sinónimos: FLJ30273, LCA3, SDR7C2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1E11, monoclonal
• formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: capture ELISA: suitable; immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_152443
• Nº de acceso UniProt: Q96NR8
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... RDH12(145226)

Descripción

Descripción general

The protein encoded by this gene is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. The encoded enzyme also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3). (provided by RefSeq)

Inmunógeno

RDH12 (NP_689656.1, 217 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNNKTAERLWNVSCELLGIRWE

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable