HPA026761

Anti-EPCAM antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti Epcam, Anti-Epcam, Epcam Antibody, Epcam Antibody - Anti-EPCAM antibody produced in rabbit, Anti-CD326 antigen, Anti-EGP, Anti-Epithelial cell surface antigen, Anti-Epithelial glycoprotein, Anti-KS 1/4 antigen, Anti-KSA, Anti-Major gastrointestinal tumor-associated protein GA733-2, Anti-Tumor-associated calcium signal transducer 1
• Número MDL: MFCD00212936
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA026761
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• validación mejorada: orthogonal RNAseq; recombinant expression; Learn more about Antibody Enhanced Validation
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• secuencia del inmunógeno: LFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYY
• Nº de acceso UniProt: P16422
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... EPCAM(4072)

Descripción

Descripción general

Epithelial cell adhesion molecule (EpCAM) gene, also referred to as TACSTD (tumor-associated calcium signal transducer) 1, is mapped to human chromosome 2p21, a region composed of the mutS homolog 2 (MSH2) and mutS homolog 6 (MSH6) DNA mismatch repair genes. The gene codes for a membrane-associated glycoprotein expressed in epithelial cells of different organs.

Inmunógeno

Tumor-associated calcium signal transducer 1 Precursor recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-EPCAM antibody produced in rabbit has been used in proximity ligation assay to study the interaction between EpCAM and AGR2 (anterior gradient-2 ) proteins.

Acciones bioquímicas o fisiológicas

Epithelial cell adhesion molecule (EpCAM) might function as a hepatic stem/progenitor cell-specific marker. EpCAM is an oncogene activated by deliverance of its intracellular domain, which is involved in transducing signals into the cell nucleus by associating with elements of the wnt pathway. Since the epithelial cell adhesion molecule (EpCAM) is highly expressed in premalignant hepatic tissues and in a subset of hepatocellular carcinoma (HCC), it might act as an early biomarker of hepatocellular carcinoma (HCC). EpCAM gene mutation leads to a rare autosomal recessive diarrheal disorder in infants called congenital tufting enteropathy (CTE). Like other cell adhesion molecules, EpCAM plays a crucial role in cell-cell interaction and it is also associated with tight junction protein, like claudin-7. Experimental studies hypothesize that EpCAM is involved in normal intestinal and crypt villus axis development .

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST70142

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable