Saltar al contenido
Merck
Todas las fotos(3)

Key Documents

SAB1401724

Sigma-Aldrich

Monoclonal Anti-SSH1 antibody produced in mouse

clone 2F9, purified immunoglobulin, buffered aqueous solution

Sinónimos:

FLJ38102, KIAA1298, SSH-1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(3)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

2F9, monoclonal

formulario

buffered aqueous solution

reactividad de especies

human

técnicas

capture ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso NCBI

NM_018984

Nº de acceso UniProt

Q8WYL5

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SSH1(54434)

Descripción general

The ADF (actin-depolymerizing factor)/cofilin family (see MIM 601442) is composed of stimulus-responsive mediators of actin dynamics. ADF/cofilin proteins are inactivated by kinases such as LIM domain kinase-1 (LIMK1; MIM 601329). The SSH family appears to play a role in actin dynamics by reactivating ADF/cofilin proteins in vivo (Niwa et al., 2002 [PubMed 11832213]).[supplied by OMIM

Inmunógeno

SSH1 (NP_061857.2, 752 a.a. ~ 849 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PKSLLLKNSHCDKNPPSTEVVIKEESSPKKDMKPAKDLRLLFSNESEKPTTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPAPPSRDGPAS

Aplicación

Monoclonal Anti-SSH1 antibody produced in mouse is suitable for capture ELISA and western blot assay.

Acciones bioquímicas o fisiológicas

SSH1 (Slingshot protein phosphatase 1) is mainly involved in the actin filament organization. During cytokinesis, it reactivates ADF (actin-depolymerizing factor)/cofilin, which plays a major role in actin filament dynamics and cell migration. Apart from cofilin reactivation, it also dephosphorylates P-cofilin in vitro and in vivo. Overexpression of SSH1 has been reported in pancreatic cancer (PC) cells, which indicates its role in tumor cell migration via SSH1L/cofilin-1 signal pathway.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Ryusuke Niwa et al.
Cell, 108(2), 233-246 (2002-02-08)
The ADF (actin-depolymerizing factor)/cofilin family is a stimulus-responsive mediator of actin dynamics. In contrast to the mechanisms of inactivation of ADF/cofilin by kinases such as LIM-kinase 1 (LIMK1), much less is known about its reactivation through dephosphorylation. Here we report
Noriko Kaji et al.
The Journal of biological chemistry, 278(35), 33450-33455 (2003-06-17)
During cytokinesis the actomyosin-based contractile ring is formed at the equator, constricted, and then disassembled prior to cell abscission. Cofilin stimulates actin filament disassembly and is implicated in the regulation of contractile ring dynamics. However, little is known about the
Yufeng Wang et al.
Cancer letters, 360(2), 171-176 (2015-02-17)
Slingshot-1L (SSH1L), a cofilin-phosphatase, plays a role in actin dynamics and cell migration by reactivating cofilin-1. However, the expression of SSH1L in malignant diseases is poorly understood. The overexpression of SSH1L in cancerous tissue compared to the matched surrounding non-cancerous

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico