SAB1401263

Monoclonal Anti-NFIX antibody produced in mouse

clone 3D2, purified immunoglobulin, buffered aqueous solution

• Sinónimos: NF1A
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 3D2, monoclonal
• formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: capture ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_002501
• Nº de acceso UniProt: Q14938
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... NFIX(4784)

Descripción

Descripción general

Nuclear factor I X (NFIX) is encoded by the gene mapped to human chromosome 19p13.13. The encoded protein is a member of the nuclear factor one (NFI) family of transcription factors.

Inmunógeno

NFIX (NP_002492.2, 291 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIR

Aplicación

Monoclonal Anti-NFIX antibody produced in mouse has been used in chromatin immunoprecipitation (ChIP) and immunofluorescence (IF).

Acciones bioquímicas o fisiológicas

Nuclear factor I X (NFIX) plays a vital role in normal brain and skeletal development. The encoded protein regulates c-Mpl (thrombopoietin receptor) transcription and promote survival of hematopoietic stem and progenitor cells (HSPCs). Mutation in the gene has been observed in Sotos-like features and Marshall–Smith syndrome patients.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable