SAB1400121

Monoclonal Anti-HDAC1 antibody produced in mouse

clone 5C11, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-DKFZp686H12203, Anti-GON10, Anti-HD1, Anti-RPD3, Anti-RPD3L1
• Número MDL: MFCD01633420
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 5C11, monoclonal
• formulario: buffered aqueous solution
• reactividad de especies: human, rat, mouse
• técnicas: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• isotipo: IgG1κ
• Nº de acceso UniProt: Q13547
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... HDAC1(3065)

Descripción

Descripción general

Histone deacetylase 1 (HDAC1) is mainly expressed in the nucleus. It belongs to class I of histone deacetylases and the gene encoding it is localized on human chromosome 1p35.2.

Inmunógeno

HDAC1 (AAH00301, 1 a.a. ~ 482 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA

Acciones bioquímicas o fisiológicas

Histone deacetylase 1 (HDAC1) is an epigenetic factor. It is part of the innate antiviral response. The protein has roles in DNA repair, splicing, regulation of gene expression and cell division. It deacetylates lysine residues of histone H3 and H4. HDAC1 has been shown to have a role in various cancers.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable