I17001
Interferon-γ human
IFN-gamma, recombinant, expressed in HEK 293 cells, suitable for cell culture, endotoxin tested
Sinónimos:
IFN-γ
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
recombinante
expressed in HEK 293 cells
Nivel de calidad
Análisis
≥98% (SDS-PAGE)
formulario
lyophilized powder
potencia
≤0.250 ng/mL In Viral Resistance Assay ED50
mol peso
16 kDa (glycosylated)
técnicas
cell culture | mammalian: suitable
idoneidad
endotoxin tested
temp. de almacenamiento
−20°C
¿Está buscando productos similares? Visita Guía de comparación de productos
Descripción general
Interferon-γ (IFN-γ) is a pleotropic cytokine, encoded by the gene mapped to human chromosome 12q15. It is a non-covalent homodimer with two identical 17kDa polypeptide chains. It belongs to the type II class of interferons.
Recombinant human Interferon-γ (IFN-γ) is expressed in human 293 cells as a glycoprotein with a calculated molecular mass of 16 kDa. This protein is manufactured in human cells using an all-human production system, with full chemically defined ingredients and with no serum. The human cells expression system allows human-like glycosylation and folding, and often supports better stability of the protein in culture. The bioactivity of IFN-γ expressed in human 293 cells is significantly higher compared to bacterially expressed IFN-γ.
Aplicación
Interferon-γ human has been used in cytometric bead array to measure the levels of interferon-γ in the sample.
It has also been used for cytokine treatment of human islets to evaluate the activation of hypoxia inducible factor 1 α (HIF1α) targets, in vitro.
Acciones bioquímicas o fisiológicas
IFN-γ is a dimerized soluble cytokine that is the only member of the type II class of interferons.
Interferon-γ (IFN-γ) plays an essential role in function of virtually all immune cells and both innate and adaptive immune responses. IFN-γ exhibits various biological effects, such as antiviral activity, inhibition of cell or tumor growth and promotion of terminal differentiation of B cells into immunoglobulin-producing cells. This cytokine also activates macrophages, increases cytotoxicity of natural killer cells and promotes T cell cytotoxicity. In addition to antiviral activity, recombinant human IFN-γ is a potent modulator of immune responses and modifies cellular processes.
Interferon-γ (IFN-γ) plays an essential role in function of virtually all immune cells and both innate and adaptive immune responses. IFN-γ exhibits various biological effects, such as antiviral activity, inhibition of cell or tumor growth and promotion of terminal differentiation of B cells into immunoglobulin-producing cells. This cytokine also activates macrophages, increases cytotoxicity of natural killer cells and promotes T cell cytotoxicity. In addition to antiviral activity, recombinant human IFN-γ is a potent modulator of immune responses and modifies cellular processes.
Secuencia
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Forma física
Supplied as a lyophilized powder containing phosphate buffered saline.
Nota de análisis
The biological activity of recombinant human IFN-γ was tested in culture in a viral resistance assay. The ED50 is defined as the effective concentration of IFN-γ that allows 50% cell growth in an antiviral cell based bioassay.
Código de clase de almacenamiento
11 - Combustible Solids
Clase de riesgo para el agua (WGK)
WGK 2
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Los clientes también vieron
Clinical use of interferon?γ.
Miller C H, et al.
Annals of the New York Academy of Sciences, 1182(1), 69-79 (2009)
The IFNγ receptor: a paradigm for cytokine receptor signaling.
Bach E A, et al.
Annual Review of Immunology, 15(1), 563-591 (1997)
Class II cytokine receptors and their ligands: key antiviral and inflammatory modulators.
Renauld J C.
Nature Reviews: Immunology, 3(8), 667-667 (2003)
Expression and reconstitution of a biologically active mouse interferon gamma receptor in hamster cells. Chromosomal location of an accessory factor.
Hibino Y, et al.
The Journal of Biological Chemistry, 266(11), 6948-6951 (1991)
David A Constant et al.
ImmunoHorizons, 6(7), 416-429 (2022-07-06)
The three types of IFN have roles in antimicrobial immunity and inflammation that must be properly balanced to maintain tissue homeostasis. For example, IFNs are elevated in the context of inflammatory bowel disease and may synergize with inflammatory cytokines such
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico