HPA020453

Anti-RASAL2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

• Sinónimos: Anti-RAS protein activator-like 1, Anti-Ras GTPase-activating protein nGAP
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA020453
• NACRES: NA.41
• conjugado: unconjugated
• application: IHC
• clon: polyclonal
• reactividad de especies: human, mouse
• citations: 3
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulario: buffered aqueous glycerol solution
• reactividad de especies: human, mouse
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50
• secuencia del inmunógeno: LSVLHSLLWEVVSQLDKATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFTEHNSSPNVSGSLSSGLQKIFEDPT
• Nº de acceso UniProt: Q9UJF2
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... RASAL2(9462)

Descripción

Descripción general

RAS protein activator like 2 (RASAL2) is a GTPase activating protein (GAPs) and possesses a GAP-related domain (GRD).

Inmunógeno

Ras GTPase-activating protein nGAP recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Acciones bioquímicas o fisiológicas

RAS protein activator like 2 (RASAL2) stimulates the signaling by Ras-related C3 botulinum toxin substrate 1 (RAC1) which is a small GTPase. This is done by binding to the complex involving RAC1 and other proteins. It acts as a tumor suppressor in breast cancer. RASAL2 has also been shown to control epithelial-mesenchymal transition (EMT) and promote metastasis in ovarian cancer. Its knockdown in ovarian cancer cells promoted cell growth, invasion and overall cancer progression.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST74618

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable