HPA015284

Anti-HLTF antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-DNA-binding protein/plasminogen activator inhibitor 1 regulator, Anti-HIP, Anti-Helicase-like transcription factor, Anti-SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3, Anti-Sucrose nonfermenting protein 2-like 3
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA015284

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human, mouse, rat
• validación mejorada: orthogonal RNAseq; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• secuencia del inmunógeno: LKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSEKDRPENVHGGILADDMGLGK
• Nº de acceso UniProt: Q14527
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... HLTF(6596)

Descripción

Descripción general

HLTF (helicase-like transcription factor) is a seven DNA helicase domain containing member of the SWI/SNF (mating-type switching/sucrose non-fermenting) family. Studies in HeLa cells show six isoforms of this protein, with the full length protein having a molecular weight of 115kDa. The 95kDa form lacks the helicase domains, present at the C-terminal, which are involved in DNA repair. It is a human ortholog of yeast Rad5 protein. This protein contains a Rad5-like domain, and a SWI/SNF helicase domain. This domain contains a C2HC4 RING domain.

Inmunógeno

Helicase-like transcription factor recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-HLTF antibody is suitable for chromatin immunoprecipitation (ChIP). Anti-HLTF antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Acciones bioquímicas o fisiológicas

HLTF (helicase-like transcription factor) interacts and binds with DNA to control transcription. It utilizes the energy of ATP hydrolysis for chromatin remodeling, which is basic to multiple cellular processes. It plays a role in post-replication DNA repair, where it functions as E3 ubiquitin ligase and uniquitinates proliferating cell nuclear antigen (PCNA). This protein, along with translesion synthesis polymerases, is recruited to chromatin by the tumor suppressor protein BRCA1 (breast cancer 1, early onset). In stalled damaged DNA replication, this protein repairs the gaps in the replication fork. HLTF is hypermethylated and inactivated in multiple cancers such as, esophageal, gastric, colorectal and uterine cancer. Its expression correlates with the progression of thyroid neoplasia. Thus, it has potential as a marker to differentiate benign from malignant thyroid tumors. In cervical cancer, it increases the DNA repair capacity, and thus, confers resistance to radiotherapy.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST73675

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)