HPA006660
Anti-LMNA antibody produced in rabbit
affinity isolated antibody, buffered aqueous glycerol solution
Sinónimos:
Anti-70 kDa lamin, Anti-Lamin-A/C, Anti-Renal carcinoma antigen NY-REN-32
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
formulario
buffered aqueous glycerol solution
reactividad de especies
human
validación mejorada
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
técnicas
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
secuencia del inmunógeno
EVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRE
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... LMNA(4000)
Categorías relacionadas
Descripción general
Lamin A/C (LMNA) gene codes for lamin A and lamin C protein. Lamin A is a nuclear intermediate filament protein. The LMNA gene is mapped to human chromosome 1q22.
Inmunógeno
Lamin-A/C recombinant protein epitope signature tag (PrEST)
Aplicación
Anti-LMNA antibody produced in rabbit has been used in:
- western blotting (1:100)
- immunostaining (1:10)
- indirect immunofluorescence
- confocal microscopy (1:100)
Acciones bioquímicas o fisiológicas
Lamins play a key role in nuclear stability, chromatin organization, and gene expression. Lamin A (LMNA) participates in the structural organization of the nucleus. It modulates gene expression via interaction with signaling molecules and transcription factors. Different mutations in the LMNA gene results in several genetic disorders called laminopathies. Mutations in the LMNA gene are also associated with muscular dystrophies, neuropathies, dilated cardiomyopathy with conduction disease, lipodystrophies, and premature aging diseases.
Características y beneficios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligadura / enlace
Corresponding Antigen APREST70720
Forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Información legal
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Producto relacionado
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 1
Equipo de protección personal
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Manindra Bera et al.
Biochemistry, 53(46), 7247-7258 (2014-10-25)
A- and B-type lamins are intermediate filament proteins constituting the nuclear lamina underneath the nuclear envelope thereby conferring proper shape and mechanical rigidity to the nucleus. Lamin proteins are also shown to be related diversely to basic nuclear processes. More
M A Bogdanova et al.
Tsitologiia, 56(4), 260-267 (2014-12-17)
Nuclear lamins are the major proteins of nuclear envelope and provide the strength of nuclear membrane as well as the interaction of extra-nuclear structures with components of cell nucleus. Recently, it became clear that lamins not only play a structural
Rasha A Al-Saaidi et al.
European journal of heart failure, 20(10), 1404-1412 (2018-06-27)
Lamin A/C mutations are generally believed to be associated with a severe prognosis. The aim of this study was to investigate disease expression in three affected families carrying different LMNA missense mutations. Furthermore, the potential molecular disease mechanisms of the
Anna Sowińska-Seidler et al.
Journal of applied genetics, 59(3), 281-289 (2018-05-31)
Craniosynostosis (CS) refers to the group of craniofacial malformations characterized by the premature closure of one or more cranial sutures. The disorder is clinically and genetically heterogeneous and occurs usually as an isolated trait, but can also be syndromic. In
Lu Kong et al.
Carcinogenesis, 33(4), 751-759 (2012-02-04)
Prostate cancer (PC) remains the second most common cause of cancer-related death in Western countries. A previous proteomics study suggested that the nuclear membrane protein lamin A/C to be a maker to discriminate low- and high-Gleason score tumors and to
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico