AV54575
Anti-GFRA2 antibody produced in rabbit
affinity isolated antibody
Sinónimos:
Anti-GDNF family receptor α2, Anti-GDNFRB, Anti-NRTNR-ALPHA, Anti-NTNRA, Anti-RETL2, Anti-TRNR2
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
formulario
buffered aqueous solution
mol peso
47 kDa
reactividad de especies
horse, dog, mouse, rat, human, pig, rabbit
concentración
0.5 mg - 1 mg/mL
técnicas
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
Información sobre el gen
human ... GFRA2(2675)
Inmunógeno
Synthetic peptide directed towards the C terminal region of human GFRA2
Aplicación
Anti-GFRA2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Acciones bioquímicas o fisiológicas
GFRA2 are cell surface bound glycoproteins that mediate interactions of the glial-cell-line-derived neurotrophic factor (GDNF) ligand family with the RET receptor that are crucial for the development of kidney and some peripheral nerve lineages. GFRA2 gene is shown to be associated with tardive dyskinesia in a study. The factors GDNF and neurturin, along with their receptors GFRA1 and GFRA2, respectively, are crucial for enteric neuron survival in human colon. The gene is shown to be associated with schizophrenia and clozapine response in a study. It is associated with severe abdominal pain sensation in pancreatic cancer patients.
Secuencia
Synthetic peptide located within the following region: NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 3
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
M Barrenschee et al.
Cell and tissue research, 354(2), 371-380 (2013-07-25)
Two of the glial-cell-line-derived neurotrophic factor (GDNF) family ligands (GFLs), namely GDNF and neurturin (NRTN), are essential neurotropic factors for enteric nerve cells. Signal transduction is mediated by a receptor complex composed of GDNF family receptor alpha 1 (GFRα1) for
J B Vanhorne et al.
Human genetics, 108(5), 409-415 (2001-06-21)
The glial-cell-line-derived neurotrophic factor (GDNF) family receptors alpha (GFRalpha) are cell surface bound glycoproteins that mediate interactions of the GDNF ligand family with the RET receptor. These interactions are crucial to the development of the kidney and some peripheral nerve
Renan P Souza et al.
Journal of psychiatric research, 44(11), 700-706 (2010-02-02)
GDNF (glial-cell-line derived neurotrophic factor) is a potent neurotrophic factor for dopaminergic neurons. Neuropsychiatric diseases and their treatments are associated with alterations in the levels of both GDNF and its receptor family (GDNF family receptor alpha or GFRA). GFRA1, GFRA2
Renan P Souza et al.
Psychopharmacology, 210(3), 347-354 (2010-04-07)
Tardive dyskinesia (TD) has a pharmacogenetic component in which the interaction of antipsychotic exposure with individual genetic variation mediates risk. The glial cell line-derived neurotrophic factor (GDNF) signalling pathway has been associated with neuroprotective effects in central dopaminergic neurons and
Kun Wang et al.
Carcinogenesis, 35(1), 103-113 (2013-09-27)
Neurotrophic factors possess an emerging role in the pathophysiology of several gastrointestinal disorders, regulating innervation, pain sensation and disease-associated neuroplasticity. Here, we aimed at characterizing the role of the neurotrophic factor neurturin (NRTN) and its receptor glial-cell-line-derived neurotrophic factor receptor
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico