Saltar al contenido
Merck
Todas las fotos(1)

Key Documents

AV54286

Sigma-Aldrich

Anti-EPHX1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-EPHX, Anti-EPOX, Anti-Eoxide hydrolase 1, microsomal (xenobiotic), Anti-MEH

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

53 kDa

reactividad de especies

horse, goat, guinea pig, rat, human, mouse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_001129490

Nº de acceso UniProt

P07099

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... EPHX1(2052)

Categorías relacionadas

Inmunógeno

Synthetic peptide directed towards the middle region of human EPHX1

Aplicación

Anti-EPHX1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Acciones bioquímicas o fisiológicas

EPHX1 [Epoxide hydrolase 1, microsomal (xenobiotic)] gene encodes a biotransformation enzyme that metabolizes arene and aliphatic epoxides to more water-soluble trans-dihydrodiol derivatives. It also plays a pivotal role in carcinogen metabolism and facilitates the sodium-dependent uptake of bile acids into hepatocytes. Mutation in EPHX1 gene results in preeclampsia, which causes increased epoxide hydrolase activity or epoxide hydrolase deficiency.

Secuencia

Synthetic peptide located within the following region: CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

J Lundbom et al.
Scandinavian journal of thoracic and cardiovascular surgery, 26(3), 187-192 (1992-01-01)
Factors influencing the effect on employment status were investigated in 250 patients (males: females 224:26) who underwent coronary artery bypass surgery between March 1983 and November 1985. The median age at operation was 57.9 (range 36.6-69.4) years and the median
Jaana Laasanen et al.
European journal of human genetics : EJHG, 10(9), 569-573 (2002-08-13)
This study determined whether genetic variability in exons 3 and 4 of the microsomal epoxide hydrolase gene jointly modifies individual preeclampsia risk. The study also determined whether genetic variability in the gene encoding for microsomal epoxide hydrolase (EPHX) contributes to
C Hassett et al.
Human molecular genetics, 3(3), 421-428 (1994-03-01)
Human microsomal epoxide hydrolase (mEH) is a biotransformation enzyme that metabolizes reactive epoxide intermediates to more water-soluble trans-dihydrodiol derivatives. We compared protein-coding sequences from six full-length human mEH DNA clones and assessed potential amino acid variation at seven positions. The

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico