AV48303

Anti-UGP2 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-UDP-glucose pyrophosphorylase 2, Anti-UDPG, Anti-UDPGP2, Anti-UGPP2, Anti-pHC379
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 56 kDa
• reactividad de especies: horse, rabbit, bovine, mouse, human, dog, guinea pig, rat
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_001001521
• Nº de acceso UniProt: Q16851-2
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... UGP2(7360)

Descripción

Descripción general

UDP-glucose pyrophosphorylase 2 (UGP2) is an intermediary enzyme that transports glucose from glucose-1-phosphate to MgUTP. Studies in pigs have revealed that UGP2 is highly expressed in the liver and skeletal muscle cells.
Rabbit Anti-UGP2 antibody recognizes zebrafish, canine, chicken, bovine, pig, human, mouse, and rat UGP2.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human UGP2

Aplicación

Rabbit Anti-UGP2 antibody is suitable for western blot applications at a concentration of 0.25μg/ml.

Acciones bioquímicas o fisiológicas

UGP2 is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme.The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene.

Secuencia

Synthetic peptide located within the following region: TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable