AV48174

Anti-IGFBP7 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-FSTL2, Anti-IGFBP-7, Anti-IGFBP-7v, Anti-Insulin-like growth factor binding protein 7, Anti-MAC25, Anti-PSF
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 29 kDa
• reactividad de especies: horse, human, rat, guinea pig, dog, bovine, rabbit
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_001544
• Nº de acceso UniProt: Q16270
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... IGFBP7(3490)

Descripción

Descripción general

Insulin-like growth factor binding protein 7 (IGFBP7) is a protein that strongly binds to IGF-I and with low affinity to IGF-II. It is known to mediate cell adhesion and the production of prostacyclin. Loss of IGFBP7 expression has been associated with tumorigenesis.
Rabbit Anti-IGFBP7 antibody recognizes human, canine, bovine, pig, mouse, and rat IGFBP7.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human IGFBP7

Aplicación

Rabbit Anti-IGFBP7 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Acciones bioquímicas o fisiológicas

IGFBP7 contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 IGFBP N-terminal domain and 1 Kazal-like domain. It binds IGF-I and IGF-II with a relatively low affinity. IGFBP7 stimulates prostacyclin (PGI2) production.

Secuencia

Synthetic peptide located within the following region: RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable