AV47617

Anti-SETD2 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-FLJ16420, Anti-FLJ22472, Anti-FLJ23184, Anti-FLJ45883, Anti-HIF-1, Anti-HSPC069, Anti-HYPB, Anti-SET domain containing 2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• forma del anticuerpo: IgG fraction of antiserum
• Nivel de calidad: 100
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 97 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_054878
• Nº de acceso UniProt: Q9BYW2
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SETD2(29072)

Descripción

Inmunógeno

Synthetic peptide directed towards the N terminal region of human SETD2

Acciones bioquímicas o fisiológicas

Huntington′s disease (HD), a neurodegenerative disorder characterized by loss of striatal neurons, is caused by an expansion of a polyglutamine tract in the HD protein huntingtin. SETD2 is a protein belonging to a class of huntingtin interacting proteins characterized by WW motifs.

Secuencia

Synthetic peptide located within the following region: SDEDSVRTSSSQRSHDLKFSASIEKERDFKKSSAPLKSEDLGKPSRSKTD

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable