Saltar al contenido
Merck
Todas las fotos(5)

Key Documents

HPA042451

Sigma-Aldrich

Anti-SETD2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Setd2 Antibody, Setd2 Antibody - Anti-SETD2 antibody produced in rabbit, Anti-Flj23184, Anti-Hif-1, Anti-Hypb, Anti-Kiaa1732, Anti-Kmt3a, Anti-Set domain containing 2

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.43

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

secuencia del inmunógeno

NLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSSQYVA

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SETD2(29072)

Descripción general

SET domain containing 2 (SETD2) is a histone methyltransferase gene and is mapped on human chromosome 3p21.31, a region associated with growth arrest of cancer cells.

Inmunógeno

SET domain containing 2 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-SETD2 antibody produced in rabbit has been used in immunohistochemistry.

Acciones bioquímicas o fisiológicas

SET domain containing 2 (SETD2) plays a vital role in trimethylation of the histone mark H3K36 (histone 3 lysine 36). Mutation of this tumor suppressor gene (TSG) is associated with the pathogenesis of various cancers including, clear cell renal cell carcinoma (cRCC), breast cancer, lung cancer, acute lymphoblastic leukemia(ALL), and glioma. In addition, SETD2 gene is also involved in the development of Huntington′s disease (HD). SETD2 plays an important role in the transcriptional elongation by maintaining chromatin structure through association with hyperphosphorylated RNA polymerase II (POLR2A). SETD2 interacts with p53 and acts as a tumor suppressor in breast cancer cells. SETD2 is implicated in DNA double-strand break (DSB) exclusion and homologous recombination (HR) repair in human cells. SETD2 in HeLa cells alters nucleosome organization via decreasing the recruitment of the FACT (facilitates chromatin transcription) complex to active genes.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST79513

Forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

SETD2 loss-of-function promotes renal cancer branched evolution through replication stress and impaired DNA repair.
Kanu N
Oncogene null
SETD2-dependent histone H3K36 trimethylation is required for homologous recombination repair and genome stability.
Pfister SX
Cell Reports null
Histone methyltransferase gene SETD2 is a novel tumor suppressor gene in clear cell renal cell carcinoma.
Duns G
Cancer Research null
In Young Park et al.
mAbs, 8(8), 1590-1597 (2016-10-30)
Posttranslational modifications (PTMs) on microtubules differentiate these cytoskeletal elements for a variety of cellular functions. We recently identified SETD2 as a dual-function histone and microtubule methyltransferase, and methylation as a new microtubule PTM that occurs on lysine 40 of α-tubulin
G Martinelli et al.
Leukemia, 32(1), 139-148 (2017-07-01)
The molecular basis of advanced systemic mastocytosis (SM) is not fully understood and despite novel therapies the prognosis remains dismal. Exome sequencing of an index-patient with mast cell leukemia (MCL) uncovered biallelic loss-of-function mutations in the SETD2 histone methyltransferase gene.

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico