Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV46745

Sigma-Aldrich

Anti-CORIN antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-ATC2, Anti-CRN, Anti-Lrp4, Anti-MGC119742, Anti-TMPRSS10

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

74 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_006578

Nº de acceso UniProt

Q9Y5Q5

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CORIN(10699)

Inmunógeno

Synthetic peptide directed towards the C terminal region of human CORIN

Aplicación

Anti-CORIN antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/mL.

Acciones bioquímicas o fisiológicas

CORIN gene encodes for a single-pass type II membrane protein. It is a transmembrane cardiac serine protease that plays a pivotal role in converting pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide that regulates blood volume and pressure. In pregnant female, it stimulates the trophoblast invasion and spiral artery remodeling in uterus. Additionally, soluble corin facilitates as a potent biomarker for heart failure (HF).

Secuencia

Synthetic peptide located within the following region: HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Joshua R Huot et al.
American journal of cancer research, 11(6), 2990-3001 (2021-07-13)
Skeletal muscle wasting and weakness caused by cancer and its treatments (known as "cachexia") drastically impair quality of life and worsen survival outcomes in cancer patients. There are currently no approved treatments for cachexia. Hence, further investigation into the causes
Ningzheng Dong et al.
Clinica chimica acta; international journal of clinical chemistry, 413(3-4), 378-383 (2011-11-19)
Corin is a transmembrane serine protease identified in the heart, where it converts natriuretic peptides from inactive precursors to mature active forms. Studies in animal models and patients with hypertension and heart disease demonstrate that corin is critical in maintaining
W Yan et al.
Proceedings of the National Academy of Sciences of the United States of America, 97(15), 8525-8529 (2000-07-06)
Atrial natriuretic peptide (ANP) is a cardiac hormone essential for the regulation of blood pressure. In cardiac myocytes, ANP is synthesized as a precursor, pro-ANP, that is converted to biologically active ANP by an unknown membrane-associated protease. Recently, we cloned
Yujie Cui et al.
Nature, 484(7393), 246-250 (2012-03-23)
In pregnancy, trophoblast invasion and uterine spiral artery remodelling are important for lowering maternal vascular resistance and increasing uteroplacental blood flow. Impaired spiral artery remodelling has been implicated in pre-eclampsia, a major complication of pregnancy, for a long time but

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico