AV44660

Anti-LRRC26 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-bA350O14.10
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 37 kDa
• reactividad de especies: dog, human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_001013675
• Nº de acceso UniProt: Q2I0M4
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... LRRC26(389816)

Descripción

Descripción general

Leucine-rich repeat (LRR)-containing protein 26 (LRRC26) functions as an auxiliary protein that complexes with and modulates the activation requirements of large-conductance, voltage- and calcium-activated potassium (BK, or K(Ca)1.1) and alkaline activated Slo channels. LRRC26 modulates the gating of a BK channel by enhancing the allosteric coupling between voltage-sensor activation and the channel′s closed-open transition.

Especificidad

Anti-LRRC26 polyclonal antibody reacts with canine and human leucine-rich repeat (LRR)-containing protein 26 proteins.

Inmunógeno

Synthetic peptide directed towards the middle region of human LRRC26

Aplicación

Anti-LRRC26 polyclonal antibody is used to tag leucine-rich repeat (LRR)-containing protein 26 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of leucine-rich repeat (LRR)-containing protein 26 as a modulator of BK channel hyperpolarization activation and Slo3 channel alkalization activation.

Secuencia

Synthetic peptide located within the following region: LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable