Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

HPA039255

Sigma-Aldrich

Anti-NPAS4 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-BHLHe79, Anti-Le-PAS, Anti-NXF, Anti-Neuronal PAS domain protein 4, Anti-PASD10

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunohistochemistry: 1:50- 1:200

secuencia del inmunógeno

YLTFPSGPEPSLQAELSKDLVCTPPYTPHQPGGCAFLFSLHEPFQTHLPTPSSTLQEQLTPSTATFSDQLTPSSATFPDPLTSPLQGQLTETS

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... NPAS4(266743)

Descripción general

The gene NPAS4 (neuronal PAS domain protein 4) is mapped to human chromosome 11q13. It is also referred to as NXF (neuronal transcription factor) and LE-PAS (limbic-enriched PAS domain protein). The encoded protein belongs to the basic helix-loop-helix (bHLH)-PAS (Per-ARNT-Sim) protein family. NPAS4 is mainly expressed in the brain and low levels are also present in the testis. The protein is present in the nucleus.
NPAS4 protein interacts with:

Inmunógeno

neuronal PAS domain protein 4 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-NPAS4 antibody produced in rabbit has been used in western blotting.

Acciones bioquímicas o fisiológicas

NPAS4 (neuronal PAS domain protein 4) is an activity-related transcription factor. It controls inhibitory and excitatory synapse formation. This action of NPAS4 depends on the neuronal cell type. NPAS4 also regulates the expression of brain-derived neurotrophic factor (BDNF), a neurotrophin required for neuronal viability, differentiation and synaptic plasticity. NPAS4 is associated with cognitive and social neurobehavior. In addition, it is involved in hippocampus- and amygdala-linked learning and memory. NPAS4 is also linked with psychiatric disorders, including bipolar disorder, autism spectrum disorder and cognition-associated disorders. This gene is also expressed during ischemic stroke and protects neurons against neurodegenerative insults.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST80909

Forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

The Role of the Neuroprotective Factor Npas4 in Cerebral Ischemia.
Choy FC, et al.
International Journal of Molecular Sciences, 16, 29011-29028 (2015)
Identification of a novel basic helix-loop-helix-PAS factor, NXF, reveals a Sim2 competitive, positive regulatory role in dendritic-cytoskeleton modulator drebrin gene expression.
Ooe N, et al.
Molecular and Cellular Biology, 24, 608-608 (2004)
Epigenetic mechanisms in the development of memory and their involvement in certain neurological diseases.
Rosales-Reynoso MA, et al.
Neurologia (Barcelona, Spain), 31, 628-638 (2016)
Thilo Speckmann et al.
The Journal of biological chemistry, 291(6), 2682-2695 (2015-12-15)
Cytosolic calcium influx activates signaling pathways known to support pancreatic beta cell function and survival by modulating gene expression. Impaired calcium signaling leads to decreased beta cell mass and diabetes. To appreciate the causes of these cytotoxic perturbations, a more

Global Trade Item Number

Número de referencia del producto (SKU)GTIN
HPA039255-100UL4061837129964
HPA039255-25UL4061841189565

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico