AV42553

Anti-AKR1B10 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-AKR1B11, Anti-AKR1B12, Anti-ALDRLn, Anti-ARL-1, Anti-ARL1, Anti-Aldo-keto reductase family 1, member B10 (aldose reductase), Anti-HIS, Anti-HSI
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 35 kDa
• reactividad de especies: rabbit, human, dog, yeast, horse, mouse
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_064695
• Nº de acceso UniProt: O60218
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... AKR1B10(57016)

Descripción

Descripción general

Aldo-keto reductase family 1B10 (AKR1B10) exhibits restricted lipid substrate specificity including farnesal, geranylgeranial, retinal and carbonyls; wherein metabolizing these lipid substrates has a crucial role in promoting carcinogenesis. AKR1B10 and 1B12 display high catalytic efficiency with all-trans-retinaldehyde. Aldo-keto reductase 1B10 (AKR1B10) is a secretory protein that is upregulated with tumorigenic transformation of human mammary epithelial cells. It is a tumor marker for cancers such as pancreatic cancer, lung carcinomas.

Especificidad

Anti-AKR1B10 polyclonal antibody reacts with human, mouse, rat, and zebrafish aldo-keto reductase family 1, member B10 (aldose reductase) enzymes..

Inmunógeno

Synthetic peptide directed towards the N terminal region of human AKR1B10

Aplicación

Anti-AKR1B10 polyclonal antibody is used to tag advanced AKR1B10 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a potential tumor marker for pancreatic and lung cancer.

Acciones bioquímicas o fisiológicas

AKR1B10 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

Secuencia

Synthetic peptide located within the following region: NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable