AV39353
Anti-DCP1A (AB2) antibody produced in rabbit
IgG fraction of antiserum
Sinónimos:
Anti-DCP1 decapping enzyme homolog A (S. cerevisiae)
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
IgG fraction of antiserum
tipo de anticuerpo
primary antibodies
clon
polyclonal
Formulario
buffered aqueous solution
mol peso
56 kDa
reactividad de especies
rat, bovine, horse, guinea pig, human, rabbit, dog
concentración
0.5 mg - 1 mg/mL
técnicas
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... DCP1A(55802)
Descripción general
DCP1A is an mRNA decapping enzyme that is involved in TGF-β signaling. DCP1A is known to be hyper-phosphorylated during mitosis, cellular stress, neuronal differentiation and brain development. DCP1A has also been implicated in translational arrest.
Rabbit Anti-DCP1A antibody recognizes rat, human, chicken, bovine, canine, zebrafish, and mouse DCP1A.
Rabbit Anti-DCP1A antibody recognizes rat, human, chicken, bovine, canine, zebrafish, and mouse DCP1A.
Inmunógeno
Synthetic peptide directed towards the N terminal region of human DCP1A
Aplicación
Rabbit Anti-DCP1A antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.
Acciones bioquímicas o fisiológicas
Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway.Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway.
Secuencia
Synthetic peptide located within the following region: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDI
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 1
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Jacob Blumenthal et al.
FEBS letters, 583(1), 197-201 (2008-12-17)
Decapping protein 1a (Dcp1a) is found in P-bodies and functions in mRNA cap removal prior to its degradation. The function and binding partners of Dcp1a have been thoroughly studied, however its expression pattern is still unclear. In this study we
Jonathan D Dougherty et al.
The Journal of biological chemistry, 289(7), 3936-3949 (2014-01-03)
We have shown previously that poliovirus infection disrupts cytoplasmic P-bodies in infected mammalian cells. During the infectious cycle, poliovirus causes the directed cleavage of Dcp1a and Pan3, coincident with the dispersion of P-bodies. We now show that expression of Dcp1a
Adva Aizer et al.
PloS one, 8(1), e49783-e49783 (2013-01-10)
Processing bodies (PBs) are non-membranous cytoplasmic structures found in all eukaryotes. Many of their components such as the Dcp1 and Dcp2 proteins are highly conserved. Using live-cell imaging we found that PB structures disassembled as cells prepared for cell division
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico