Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV35609

Sigma-Aldrich

Anti-TRPM3 (AB3) antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-GON-2, Anti-LTRPC3, Anti-MLSN2, Anti-Transient receptor potential cation channel, subfamily M, member 3

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

mol peso

188 kDa

reactividad de especies

dog, mouse, human, guinea pig, bovine, rat, rabbit, horse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_996829

Nº de acceso UniProt

Q9HCF6-2

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... TRPM3(80036)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human TRPM3

Acciones bioquímicas o fisiológicas

Transient receptor potential cation channel, subfamily M, member 3 (TRPM3) belongs to the TRP family of channels. These cation-selective channels that regulate homeostasis, calcium signaling, calcium entry and storage.

Secuencia

Synthetic peptide located within the following region: ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number
QC11696

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

Busque por un COA

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

J Oberwinkler et al.
Handbook of experimental pharmacology, (179)(179), 253-267 (2007-01-16)
TRPM3 is the last identified member of the TRPM subfamily and is most closely related to TRPM1. Due to alternative splicing, the TRPM3 gene encodes a large number of different variants. One splice event, affecting the pore-forming region of the
Rika Aoki et al.
Cardiovascular research, 104(2), 326-336 (2014-09-06)
At birth, dynamic changes occur in serum components and haemodynamics, such as closure of the ductus arteriosus (DA). A previous study demonstrated that, in full-term human neonates, serum osmolality decreased transiently after birth, but recovered over the next few days.

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico