AV32715

Anti-NFATC4 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 95 kDa
• reactividad de especies: horse, rat, dog, rabbit, guinea pig, human, bovine, mouse
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_001129494
• Nº de acceso UniProt: Q14934
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... NFATC4(4776)

Descripción

Descripción general

NFATC4 forms a part of a DNA-binding transcription complex that consists of inducible cytosolic and nuclear components. NFATC4 is involved in modulating neurotrophin-mediated synaptic plasticity and can also induce interleukins 2 and 4. p38 Mitogen-activated protein (MAP) kinases can regulate NFATC4 phosphorylation.
Rabbit Anti-NFATC4 antibody recognizes canine, bovine, human, mouse, and rat NFATC4.

Inmunógeno

Synthetic peptide directed towards the middle region of human NFATC4

Aplicación

Rabbit Anti-NFATC4 antibody can be used for western blot (1.25μg/ml) and IHC (4-8μg/ml) applications.

Acciones bioquímicas o fisiológicas

NFATC4 is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. NFATC4 plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. The product of this gene plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4.

Secuencia

Synthetic peptide located within the following region: GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable