Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV31947

Sigma-Aldrich

Anti-HNF4G (AB1) antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Hepatocyte Nuclear factor 4, γ

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

46 kDa

reactividad de especies

dog, rabbit, rat, human, guinea pig

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... HNF4G(3174)

Descripción general

HNF4G is a nuclear receptor that regulates hyaluronan synthase 2 (HAS2) and facilitates the metastasis of bladder cancer.
Rabbit Anti-HNF4G recognizes chicken, mouse, canine, bovine, human, and rat HNF4G.

The previously assigned protein identifier Q7Z2V9 has been merged into Q14541. Full details can be found on the UniProt database.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human HNF4G

Aplicación

Rabbit Anti-HNF4G (AB1) antibody can be used for western blot applications at concentration of 1.0μg/ml.

Acciones bioquímicas o fisiológicas

HNF4 was first identified as a DNA binding activity in rat liver nuclear extracts and then was found to be an orphan member of the nuclear receptor superfamily. Binding sites for this factor were identified in many tissue-specifically expressed genes, and the protein was found to be essential for early embryonic development in the mouse

Secuencia

Synthetic peptide located within the following region: MSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

T Okegawa et al.
Oncogenesis, 2, e58-e58 (2013-07-31)
Nuclear receptors (NRs) are a class of transcription factors that are closely involved in the progression of certain types of cancer. We aimed to study the relation between bladder cancer and NRs, with special focus on orphan NRs whose ligands

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico