AV13110

Anti-TRH antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-MGC125964, Anti-MGC125965, Anti-Thyrotropin-releasing hormone
• Código UNSPSC: 12352203

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 26 kDa
• reactividad de especies: bovine, human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_009048
• Nº de acceso UniProt: P20396
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TRH(7200)

Descripción

Descripción general

Rabbit polyclonal anti-TRH antibody reacts with zebrafish, human, canine, chicken, and bovine thyrotrophin-releasing hormones.

Thyrotropin-releasing hormone/thyrotropin-releasing factor (TRH, TRF) is a tripeptidal hormone that stimulates the synthesis and release of TSH (thyroid-stimulating hormone) and prolactin from the anterior pituitary. TRH is a highly specific regulator of the thyrotropin-stimulating hormone (TSHβ) gene expression in the pituitary via a nerve growth factor IB (NGFIB, NR4A1, Nur77)/PKC/ERK1/2 pathway.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human TRH

Aplicación

Rabbit polyclonal anti-TRH antibody is used to tag thyrotrophin-releasing hormone for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of thyrotrophin-releasing hormone in the regulation of the synthesis and release of TSH (thyroid-stimulating hormone) and prolactin from the anterior pituitary. Anti-TRH antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Secuencia

Synthetic peptide located within the following region: RALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 12 - Non Combustible Liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable