AV100888

Anti-TRIM22 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-GPSTAF50, Anti-RNF94, Anti-STAF50, Anti-Tripartite motif-containing 22
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 57 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_006065
• Nº de acceso UniProt: Q8IYM9
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TRIM22(10346)

Descripción

Inmunógeno

Synthetic peptide directed towards the N terminal region of human TRIM22

Acciones bioquímicas o fisiológicas

TRIM22 exerts anti-viral activity against RNA viruses and is stimulated by interferon-α. It restricts the replication of influenza A virus by interacting with viral nucleoprotein followed by ubiquitination and proteasome-dependent degradation. TRIM22 also restricts the replication of encephalomyocarditis virus (EMCV), hepatitis B virus (HBV), and human immunodeficiency virus type 1 (HIV-1). It has been implicated in cellular differentiation and proliferation of certain cancers and autoimmune reactions.

Secuencia

Synthetic peptide located within the following region: LANIVERVKEVKMSPQEGQKRDVCEHHGKKLQIFCKEDGKVICWVCELSQ

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable