AV100609
Anti-GLI1 (AB2) antibody produced in rabbit
IgG fraction of antiserum
Sinónimos:
Anti-Glioma-associated oncogene homolog 1 (zinc finger protein)
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
IgG fraction of antiserum
tipo de anticuerpo
primary antibodies
clon
polyclonal
Formulario
buffered aqueous solution
mol peso
118 kDa
reactividad de especies
human, rabbit, horse
concentración
0.5 mg - 1 mg/mL
técnicas
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... GLI1(2735)
Categorías relacionadas
Inmunógeno
Synthetic peptide directed towards the N terminal region of human GLI1
Aplicación
Anti-GLI1 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.
Acciones bioquímicas o fisiológicas
GLI1 is a family of zinc finger transcription factors that mediate the effects of Hedgehog pathway. The activation of GLI1 is the effect of the binding of Shh ligand to receptor PTCH. GLI1 has been observed to be overexpressed in glioblastoma and induces the genes involved in tumor development and progression.
Secuencia
Synthetic peptide located within the following region: LRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPARETNSCTEGPLF
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 3
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Hu Zhu et al.
Current genomics, 11(4), 238-245 (2010-12-02)
Sonic hedgehog (Shh) signaling is critically important for embryogenesis and other cellular processes in which GLI transcription factors mediate the terminal effects of the pathway. GLI1, in particular, plays a significant role in human cancers. Consequently, GLI1 and its upstream
Richard L Carpenter et al.
Discovery medicine, 13(69), 105-113 (2012-03-01)
The Hedgehog signaling pathway regulates normal cell growth and differentiation. When deregulated, the Hedgehog pathway leads to tumorigenesis and supports more aggressive phenotypes of human cancers, such as progression, metastasis, and therapeutic resistance. The glioma-associated oncogene homolog 1 (GLI1) family
Young-Eun Leem et al.
PloS one, 9(11), e111701-e111701 (2014-11-05)
Hedgehog (Hh) signaling plays essential roles in various developmental processes, and its aberrant regulation results in genetic disorders or malignancies in various tissues. Hyperactivation of Hh signaling is associated with lung cancer development, and there have been extensive efforts to
Yoshiaki Kitaura et al.
PloS one, 9(10), e109597-e109597 (2014-10-15)
Hedgehog (Hh) signaling plays important roles in various development processes. This signaling is necessary for osteoblast formation during endochondral ossification. In contrast to the established roles of Hh signaling in embryonic bone formation, evidence of its roles in adult bone
Ann Marie Hynes et al.
Proceedings of the National Academy of Sciences of the United States of America, 111(27), 9893-9898 (2014-06-21)
Nephronophthisis (NPHP) is the major cause of pediatric renal failure, yet the disease remains poorly understood, partly due to the lack of appropriate animal models. Joubert syndrome (JBTS) is an inherited ciliopathy giving rise to NPHP with cerebellar vermis aplasia
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico