171596

β-Amyloid Peptide

≥80% (HPLC), lyophilized, 1-42, rat

• Sinónimos: β-Amyloid Peptide (1-42), Rat, DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
• Fórmula empírica (notación de Hill): C₁₉₉H₃₀₇N₅₃O₅₉S
• Número de CAS: 107761-42-2
• Peso molecular: 4417.95
• Número MDL: MFCD00163049
• Código UNSPSC: 12352202
• NACRES: NA.26

Propiedades

• product name: β-Amyloid Peptide (1-42), Rat,
• descripción: Predominant peptide found in the brain of patients with Alzheimer′s Disease and Down′s Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.
• Nivel de calidad: 100
• Análisis: ≥80% (HPLC)
• formulario: lyophilized
• fabricante / nombre comercial: Calbiochem^®
• condiciones de almacenamiento: OK to freeze; desiccated (hygroscopic)
• solubilidad: 5% acetic acid: 1 mg/mL
• Condiciones de envío: ambient
• temp. de almacenamiento: −20°C

Descripción

Descripción general

β-Amyloid Peptide (Aβ) is the main constituent in both senile plaques and diffuse deposits in Alzheimer′s diseased brains. Under appropriate conditions, the soluble amyloid peptides aggregate into the fibrils associated with the disease state. It has proposed that Aβ peptide may increase the sensitivity of neurons to oxidative damage by downregulating expression of bcl-2, a key anti-apoptotic protein and upregulating of bax expression, a protein known to induce cell death.

Predominant peptide found in the brain of patients with Alzheimer’s Disease and Down’s Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.

Advertencia

Toxicity: Standard Handling (A)

Secuencia

H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH

Otras notas

Paradis, E., et al. 1996. J. Neurosci.16, 7533.
Roher, A.E., et al. 1996. J. Biol. Chem.271, 20631.
Soto, C., and Castano, E.M. 1996. Biochem. J.314, 701.
Murrell, J., et al. 1991. Science254, 97.
Goldgaber, D., et al. 1987. Science235, 877.
Kang, J., et al. 1987. Nature 325, 733.

Información legal

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Código de clase de almacenamiento: 11 - Combustible Solids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable