Skip to Content
Merck
All Photos(6)

Key Documents

WH0006241M1

Sigma-Aldrich

Monoclonal Anti-RRM2 antibody produced in mouse

clone 1E1, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Rrm2 Antibody, Rrm2 Antibody - Monoclonal Anti-RRM2 antibody produced in mouse, Anti-R2, Anti-RR2M, Anti-ribonucleotide reductase M2 polypeptide

Sign Into View Organizational & Contract Pricing
All Photos(6)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1E1, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

NM_001034

UniProt accession no.

P31350

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RRM2(6241)

Related Categories

General description

The ribonucleotide reductase regulatory subunit M2 (RRM2) gene is located on the human chromosome at 2p25.1. RRM2 protein is a component of ribonucleotide reductase (RR). This protein is a dimer and each dimer consists of tyrosine free-radical and non-heme iron.

Immunogen

RRM2 (NP_001025, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLS

Application

Monoclonal Anti-RRM2 antibody produced in mouse has been used in:
  • immunohistochemistry
  • western blotting
  • immunofluorescence

Biochem/physiol Actions

Ribonucleotide reductase regulatory subunit M2 (RRM2) protein regulates the activity of ribonucleotide reductase (RR) during the G1/early S phase of the cell cycle when DNA replication takes place. This protein provides the essential precursors for DNA synthesis. RRM2 protein catalyzes the biogenesis of deoxyribonucleotides from their corresponding ribonucleotides. RRM2 protein acts as a biomarker for various human cancers. Overexpression of RRM2 gene is observed during tumor progression, cellular response to DNA damage and increased cellular invasiveness.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

RRM2 induces NF-kappaB-dependent MMP-9 activation and enhances cellular invasiveness
Duxbury M S and Whang E E
Biochemical and biophysical research communications, 354(1), 190-196 (2007)
Systemic delivery of siRNA nanoparticles targeting RRM2 suppresses head and neck tumor growth
Rahman M A, et al.
Journal of Controlled Release : Official Journal of the Controlled Release Society, 159(3), 384-392 (2012)
Potent siRNA inhibitors of ribonucleotide reductase subunit RRM2 reduce cell proliferation in vitro and in vivo
Heidel J D, et al.
Current Rheumatology Reports, 13(7), 2207-2215 (2007)
Sean G Rudd et al.
EMBO molecular medicine, 12(3), e10419-e10419 (2020-01-18)
The deoxycytidine analogue cytarabine (ara-C) remains the backbone treatment of acute myeloid leukaemia (AML) as well as other haematological and lymphoid malignancies, but must be combined with other chemotherapeutics to achieve cure. Yet, the underlying mechanism dictating synergistic efficacy of
Nina M S Gustafsson et al.
Nature communications, 9(1), 3872-3872 (2018-09-27)
The glycolytic PFKFB3 enzyme is widely overexpressed in cancer cells and an emerging anti-cancer target. Here, we identify PFKFB3 as a critical factor in homologous recombination (HR) repair of DNA double-strand breaks. PFKFB3 rapidly relocates into ionizing radiation (IR)-induced nuclear
View All Related Papers

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service